|
Click
here to view datasheet 
Mouse Monoclonal Antibody
Description: pS2 is a cysteine-rich, 6.5kDa protein found in both estrogen-dependent (breast tumors) and estrogen-independent tissues (normal stomach mucosa). About 60% of breast carcinomas are positive for pS2. Staining is cytoplasmic, often with localization to the Golgi apparatus. pS2 is primarily expressed in estrogen receptor-positive breast tumors.
Comments: Antibody to pS2 is reportedly useful in identifying a subset of estrogen-dependent breast tumors which may respond to endocrine therapy.
Epitope: aa54-84
Clone Designation:
pS2.1
Immunogen: A Synthetic 31-mer peptide aa 54-84 (KGCCFDDTVRGVPWCFYPNTIDVPPEEECEF) from the C-terminus of human pS2 protein.
Molecular Weight:6.5kDa
Species reactivity:Human. Others-not known.
Cellular Localization:Cytoplasmic
|