Antibodies Alphabetical List of Antibodies Click on letters below to search for antibodies: To search for antibodies by research interest click here. To search for New 2008 antibodies click here.

FEATURED ANTIBODY: pS2 / pNR-2 Estrogen-Regulated Protein Ab-1
Click here to view datasheet Mouse Monoclonal Antibody Description: pS2 is a cysteine-rich, 6.5kDa protein found in both estrogen-dependent (breast tumors) and estrogen-independent tissues (normal stomach mucosa). About 60% of breast carcinomas are positive for pS2. Staining is cytoplasmic, often with localization to the Golgi apparatus. pS2 is primarily expressed in estrogen receptor-positive breast tumors. Comments: Antibody to pS2 is reportedly useful in identifying a subset of estrogen-dependent breast tumors which may respond to endocrine therapy. Epitope: aa54-84 Clone Designation: pS2.1 Immunogen: A Synthetic 31-mer peptide aa 54-84 (KGCCFDDTVRGVPWCFYPNTIDVPPEEECEF) from the C-terminus of human pS2 protein. Molecular Weight:6.5kDa Species reactivity:Human. Others-not known. Cellular Localization:Cytoplasmic